Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HBG2 Peptide - middle region

HBG2 Peptide - middle region

Product Specifications

Product Name Alternative

FLJ76540

UniProt

P69892

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HBG2 Rabbit Polyclonal Antibody (orb586054) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000175

Preservative

Lyophilized powder

AA Sequence

MGNPKVKAHGKKVLTSLGDAIKHLDDLKGTFAQLSELHCDKLHVDPENFK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IMPDH2 Recombinant Antibody, PE-Cy5 Conjugated
bsm-61947R-PE-Cy5-TR 20 µL

IMPDH2 Recombinant Antibody, PE-Cy5 Conjugated

Sign In for Pricing
View Details
Gremlin-1 (C-7) : m-IgGκ BP-HRP Bundle
sc-525260 1 Kit

Gremlin-1 (C-7) : m-IgGκ BP-HRP Bundle

Sign In for Pricing
View Details
Nori® Canine PF4/CXCL4 ELISA Kit
GR115290 96 Well

Nori® Canine PF4/CXCL4 ELISA Kit

Sign In for Pricing
View Details
Fam46d siRNA Oligos set (Mouse)
20034174 3x 5 nmol

Fam46d siRNA Oligos set (Mouse)

Sign In for Pricing
View Details
CD272 Blocking Peptide
MBS8308989-01 1 mg

CD272 Blocking Peptide

Sign In for Pricing
View Details
CD272 Blocking Peptide
MBS8308989-02 5 mg

CD272 Blocking Peptide

Sign In for Pricing
View Details