Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HBG2 Peptide - middle region

HBG2 Peptide - middle region

Product Specifications

Product Name Alternative

FLJ76540

UniProt

P69892

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HBG2 Rabbit Polyclonal Antibody (orb586054) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000175

Preservative

Lyophilized powder

AA Sequence

MGNPKVKAHGKKVLTSLGDAIKHLDDLKGTFAQLSELHCDKLHVDPENFK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Akt3 Polyclonal Antibody
E44H10874 100 µL

Akt3 Polyclonal Antibody

Sign In for Pricing
View Details
ACS5 Antibody
orb783944 2 mg

ACS5 Antibody

Sign In for Pricing
View Details
Trap1a CRISPR/Cas9 KO Plasmid (m2)
sc-423500-KO-2 20 µg

Trap1a CRISPR/Cas9 KO Plasmid (m2)

Sign In for Pricing
View Details
Recombinant Human Transcription initiation factor TFIID subunit 11(TAF11)
AP76970-01 20 µg

Recombinant Human Transcription initiation factor TFIID subunit 11(TAF11)

Sign In for Pricing
View Details
Recombinant Human Transcription initiation factor TFIID subunit 11(TAF11)
AP76970-02 100 µg

Recombinant Human Transcription initiation factor TFIID subunit 11(TAF11)

Sign In for Pricing
View Details
Recombinant Human Transcription initiation factor TFIID subunit 11(TAF11)
AP76970-03 1 mg

Recombinant Human Transcription initiation factor TFIID subunit 11(TAF11)

Sign In for Pricing
View Details