Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPP3CC Peptide - C-terminal region

PPP3CC Peptide - C-terminal region

Product Specifications

Product Name Alternative

CALNA3, CNA3, PP2Bgamma

UniProt

G3V111

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PPP3CC Rabbit Polyclonal Antibody (orb586061) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

EAW63678

Preservative

Lyophilized powder

AA Sequence

FTEPPAFGPVCDLLWSDPSEDYGNEKTLEHYTHNTVRGCSYFYSYPAVCE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Pongo abelii Uncharacterized protein C8orf46 homolog
MBS1480587-01 0.02 mg (E-Coli)

Recombinant Pongo abelii Uncharacterized protein C8orf46 homolog

Sign In for Pricing
View Details
Recombinant Pongo abelii Uncharacterized protein C8orf46 homolog
MBS1480587-02 0.1 mg (E-Coli)

Recombinant Pongo abelii Uncharacterized protein C8orf46 homolog

Sign In for Pricing
View Details
Recombinant Pongo abelii Uncharacterized protein C8orf46 homolog
MBS1480587-03 0.02 mg (Yeast)

Recombinant Pongo abelii Uncharacterized protein C8orf46 homolog

Sign In for Pricing
View Details
Recombinant Pongo abelii Uncharacterized protein C8orf46 homolog
MBS1480587-04 0.1 mg (Yeast)

Recombinant Pongo abelii Uncharacterized protein C8orf46 homolog

Sign In for Pricing
View Details
Recombinant Pongo abelii Uncharacterized protein C8orf46 homolog
MBS1480587-05 0.02 mg (Baculovirus)

Recombinant Pongo abelii Uncharacterized protein C8orf46 homolog

Sign In for Pricing
View Details
Recombinant Pongo abelii Uncharacterized protein C8orf46 homolog
MBS1480587-06 0.02 mg (Mammalian-Cell)

Recombinant Pongo abelii Uncharacterized protein C8orf46 homolog

Sign In for Pricing
View Details