Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BPY2 Peptide - C-terminal region

BPY2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

BPY2A, BPY2B, BPY2C, VCY2, VCY2A

UniProt

O14599

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with BPY2 Rabbit Polyclonal Antibody (orb586066) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004669

Preservative

Lyophilized powder

AA Sequence

VRNTLLQSKVGLLTYYVKLYPGEVTLLTRPSIQMRLCCITGSVSRPRSQK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UQCRHP2 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)
LV755278 1.0 µg DNA

UQCRHP2 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
Recombinant Clostridium Difficile rplP Protein (aa 1-143)
VAng-Lsx9306-1mgEcoli 1 mg (E. coli)

Recombinant Clostridium Difficile rplP Protein (aa 1-143)

Sign In for Pricing
View Details
Recombinant Antirrhinum majus Myb-related protein 330 (MYB330)
MBS1238517-01 0.02 mg (E-Coli)

Recombinant Antirrhinum majus Myb-related protein 330 (MYB330)

Sign In for Pricing
View Details
Recombinant Antirrhinum majus Myb-related protein 330 (MYB330)
MBS1238517-02 0.02 mg (Yeast)

Recombinant Antirrhinum majus Myb-related protein 330 (MYB330)

Sign In for Pricing
View Details
Recombinant Antirrhinum majus Myb-related protein 330 (MYB330)
MBS1238517-03 0.1 mg (E-Coli)

Recombinant Antirrhinum majus Myb-related protein 330 (MYB330)

Sign In for Pricing
View Details
Recombinant Antirrhinum majus Myb-related protein 330 (MYB330)
MBS1238517-04 0.1 mg (Yeast)

Recombinant Antirrhinum majus Myb-related protein 330 (MYB330)

Sign In for Pricing
View Details