Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CTSW Peptide - N-terminal region

CTSW Peptide - N-terminal region

Product Specifications

Product Name Alternative

LYPN

UniProt

P56202

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CTSW Rabbit Polyclonal Antibody (orb326518) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001326

Preservative

Lyophilized powder

AA Sequence

TEEEFGQLYGYRRAAGGVPSMGREIRSEEPEESVPFSCDWRKVAGAISPI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue Total RNA, Myometrium
CR559598 5 µg

Tissue Total RNA, Myometrium

Sign In for Pricing
View Details
Tissue FFPE Sections, Lung
CS807750 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details
NDUFS2 (Center) Rabbit Polyclonal Antibody
AP52844PU-N 400 µL

NDUFS2 (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
C13orf1 (SPRYD7) Human Gene Knockout Kit (CRISPR)
KN423236 1 Kit

C13orf1 (SPRYD7) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
beta-DTPEBBTD-C8
TRC-D710028-100MG 100 mg

beta-DTPEBBTD-C8

Sign In for Pricing
View Details
RBP2 (NM_004164) Human Recombinant Protein
TP317970M 100 µg

RBP2 (NM_004164) Human Recombinant Protein

Sign In for Pricing
View Details