Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IPO7 Peptide - C-terminal region

IPO7 Peptide - C-terminal region

Product Specifications

Product Name Alternative

FLJ14581, Imp7, MGC138673, RANBP7

UniProt

O95373

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with IPO7 Rabbit Polyclonal Antibody (orb586106) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_006382

Preservative

Lyophilized powder

AA Sequence

NVIQKMICEYSEEVTPIAVEMTQHLAMTFNQVIQTGPDEEGSDDKAVTAM

More Discoveries

Explore Other Products

Browse additional items from our catalog

TSTD2 Protein Vector (Mouse) (pPB-C-His)
PV242554 500 ng

TSTD2 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
Cx3cr1 ORF Vector (Mouse) (pORF)
ORF042283 1.0 µg DNA

Cx3cr1 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Lman1l 3'UTR GFP Stable Cell Line
TU257123 1.0 mL

Lman1l 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
A RAF (ARAF) (NM_001654) Human Tagged ORF Clone
RG200737 10 µg

A RAF (ARAF) (NM_001654) Human Tagged ORF Clone

Sign In for Pricing
View Details
PRT062607 HCL 1mg
A12731-1 1 mg

PRT062607 HCL 1mg

Sign In for Pricing
View Details
Borussertib
BA8676-10 10 mg

Borussertib

Sign In for Pricing
View Details