Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IPO7 Peptide - C-terminal region

IPO7 Peptide - C-terminal region

Product Specifications

Product Name Alternative

FLJ14581, Imp7, MGC138673, RANBP7

UniProt

O95373

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with IPO7 Rabbit Polyclonal Antibody (orb586106) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_006382

Preservative

Lyophilized powder

AA Sequence

NVIQKMICEYSEEVTPIAVEMTQHLAMTFNQVIQTGPDEEGSDDKAVTAM

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gtf3c3 siRNA Oligos set (Mouse)
22811174 3x 5 nmol

Gtf3c3 siRNA Oligos set (Mouse)

Sign In for Pricing
View Details
Rhodojaponin-II
N2035-10 10 mg

Rhodojaponin-II

Sign In for Pricing
View Details
ELAC1 Antibody
MBS1499742-01 0.05 mg

ELAC1 Antibody

Sign In for Pricing
View Details
ELAC1 Antibody
MBS1499742-02 0.1 mg

ELAC1 Antibody

Sign In for Pricing
View Details
ELAC1 Antibody
MBS1499742-03 5x 0.1 mg

ELAC1 Antibody

Sign In for Pricing
View Details
Horse Fibroblast Activation Protein Alpha ELISA Kit
MBS085188-01 48 Well

Horse Fibroblast Activation Protein Alpha ELISA Kit

Sign In for Pricing
View Details