Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

P2RY13 Peptide - C-terminal region

P2RY13 Peptide - C-terminal region

Product Specifications

Product Name Alternative

FKSG77, GPCR1, GPR86, GPR94, P2Y13, SP174

UniProt

Q9BPV8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with P2RY13 Rabbit Polyclonal Antibody (orb586107) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_795713

Preservative

Lyophilized powder

AA Sequence

VVIAKKVYDSYRKSKSKDRKNNKKLEGKVFVVVAVFFVCFAPFHFARVPY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EVC Polyclonal Antibody
E912634 100 µL

EVC Polyclonal Antibody

Sign In for Pricing
View Details
Kojic amine
T68874-01 25 mg

Kojic amine

Sign In for Pricing
View Details
Kojic amine
T68874-02 50 mg

Kojic amine

Sign In for Pricing
View Details
Kojic amine
T68874-03 100 mg

Kojic amine

Sign In for Pricing
View Details
Tissue FFPE Sections, Bone: femur, distal
CS711721 5x 5 µm

Tissue FFPE Sections, Bone: femur, distal

Sign In for Pricing
View Details
Monkey ATP synthase lipid binding protein, mitochondrial (ATP5G2) ELISA Kit
GTR10364266 96 Well

Monkey ATP synthase lipid binding protein, mitochondrial (ATP5G2) ELISA Kit

Sign In for Pricing
View Details