Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

P2RY13 Peptide - C-terminal region

P2RY13 Peptide - C-terminal region

Product Specifications

Product Name Alternative

FKSG77, GPCR1, GPR86, GPR94, P2Y13, SP174

UniProt

Q9BPV8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with P2RY13 Rabbit Polyclonal Antibody (orb586107) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_795713

Preservative

Lyophilized powder

AA Sequence

VVIAKKVYDSYRKSKSKDRKNNKKLEGKVFVVVAVFFVCFAPFHFARVPY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cyclo (l-Pro-d-Leu)
HY-N3654 1 Each

Cyclo (l-Pro-d-Leu)

Sign In for Pricing
View Details
PIPOX (F-9) : m-IgG2a BP-HRP Bundle
sc-546859 1 Kit

PIPOX (F-9) : m-IgG2a BP-HRP Bundle

Sign In for Pricing
View Details
CNL1B 8 Die-cut & Printed Numbers & Letters
912258 250 Pack (10 Label (s) x 25 Card)

CNL1B 8 Die-cut & Printed Numbers & Letters

Sign In for Pricing
View Details
PE-Linked Monoclonal Antibody to Dickkopf Related Protein 1 (DKK1)
MBS2149373-01 0.1 mL

PE-Linked Monoclonal Antibody to Dickkopf Related Protein 1 (DKK1)

Sign In for Pricing
View Details
PE-Linked Monoclonal Antibody to Dickkopf Related Protein 1 (DKK1)
MBS2149373-02 0.2 mL

PE-Linked Monoclonal Antibody to Dickkopf Related Protein 1 (DKK1)

Sign In for Pricing
View Details
PE-Linked Monoclonal Antibody to Dickkopf Related Protein 1 (DKK1)
MBS2149373-03 0.5 mL

PE-Linked Monoclonal Antibody to Dickkopf Related Protein 1 (DKK1)

Sign In for Pricing
View Details