Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RGP1 Peptide - C-terminal region

RGP1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

KIAA0258

UniProt

Q92546

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RGP1 Rabbit Polyclonal Antibody (orb586110) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001073965

Preservative

Lyophilized powder

AA Sequence

FSVSLQTEERVQPEYQRRRGAGGVPSVSHVTHARHQESCLHTTRTSFSLP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MIRacle™ rno-let-7c-1-3p miRNA Agomir/Antagomir
AM4502 2 OD, 4 OD, 50 OD

MIRacle™ rno-let-7c-1-3p miRNA Agomir/Antagomir

Sign In for Pricing
View Details
Human Penguin (PEN) ELISA Kit
QY-E04702 96 Tests

Human Penguin (PEN) ELISA Kit

Sign In for Pricing
View Details
PRPF6 Peptide (AAP40734)
AAP40734-100UG 100 µg

PRPF6 Peptide (AAP40734)

Sign In for Pricing
View Details
UHRF1 Recombinant Protein Antigen
NBP2-68720PEP 100 µL

UHRF1 Recombinant Protein Antigen

Sign In for Pricing
View Details
ZNF397 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1F3]
TA503687AM 100 µL

ZNF397 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1F3]

Sign In for Pricing
View Details
PCDH7 Polyclonal Antibody
bs-20154R 100 µL

PCDH7 Polyclonal Antibody

Sign In for Pricing
View Details