Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CAPZA1 Peptide - N-terminal region

CAPZA1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

CAPPA1, CAPZ, CAZ1

UniProt

P52907

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CAPZA1 Rabbit Polyclonal Antibody (orb586112) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_006126

Preservative

Lyophilized powder

AA Sequence

YEDQVLITEHGDLGNSRFLDPRNKISFKFDHLRKEASDPQPEEADGGLKS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DAB1 AAV siRNA Pooled Vector
17633161 1.0 µg

DAB1 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Goose Pleckstrin (PLEK) ELISA Kit
MBS9393924 Inquire

Goose Pleckstrin (PLEK) ELISA Kit

Sign In for Pricing
View Details
Hmha1-set siRNA/shRNA/RNAi Lentivector (Mouse)
23678094 4x 500 ng

Hmha1-set siRNA/shRNA/RNAi Lentivector (Mouse)

Sign In for Pricing
View Details
C1GALT1C1 Protein Vector (Rat) (pPM-C-His)
PV256825 500 ng

C1GALT1C1 Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details
BSND Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
LV676567 1.0 µg DNA

BSND Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Cytokeratin 10 (KRT10/844), CF405S conjugate, 0.1mg/mL
BNC040844-100 1x 100 µL

Cytokeratin 10 (KRT10/844), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details