Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MGAT4EP Peptide - N-terminal region

MGAT4EP Peptide - N-terminal region

Product Specifications

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

XP_001132106

Preservative

Lyophilized powder

AA Sequence

FLWPFITLKIPKETEDDQNVMTVKGQWGISSVQQGDGSSLLYTLVSLFRV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse IgM (µ chain specific), AlpHcAbs® Goat antibody (HRP)
HA710124 100 µg

Mouse IgM (µ chain specific), AlpHcAbs® Goat antibody (HRP)

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung
CS504253 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details
MMP9 (NM_004994) Human Over-expression Lysate
LC401553 20 µg

MMP9 (NM_004994) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant Transferrin Receptor/TFRC Monoclonal Antibody
AN300555P 100 µL

Recombinant Transferrin Receptor/TFRC Monoclonal Antibody

Sign In for Pricing
View Details
CD28 (204.12), CF568 conjugate, 0.1mg/mL
BNC680164-100 1x 100 µL

CD28 (204.12), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PE/Cyanine5.5 Mouse IgM, κ Isotype Control[MM-30]
E-AB-F09783I-01 25 µg

PE/Cyanine5.5 Mouse IgM, κ Isotype Control[MM-30]

Sign In for Pricing
View Details