Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MGAT4EP Peptide - N-terminal region

MGAT4EP Peptide - N-terminal region

Product Specifications

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

XP_001132106

Preservative

Lyophilized powder

AA Sequence

FLWPFITLKIPKETEDDQNVMTVKGQWGISSVQQGDGSSLLYTLVSLFRV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CCDC158 (NM_001042784) Human Over-expression Lysate
LC420812 20 µg

CCDC158 (NM_001042784) Human Over-expression Lysate

Sign In for Pricing
View Details
ACTH (Adrenocorticotrophic Hormone) (AH26 + 57), CF647 conjugate, 0.1mg/mL
BNC471025-100 1x 100 µL

ACTH (Adrenocorticotrophic Hormone) (AH26 + 57), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
trans-4-Hydroxy-1-L-phenylalanyl-L-proline
TRC-H245550-10MG 10 mg

trans-4-Hydroxy-1-L-phenylalanyl-L-proline

Sign In for Pricing
View Details
FITC Anti-Human CD81 Antibody[1.3.3.22]
E-AB-F1073C-01 20 Tests

FITC Anti-Human CD81 Antibody[1.3.3.22]

Sign In for Pricing
View Details
FITC Anti-Human CD81 Antibody[1.3.3.22]
E-AB-F1073C-02 100 Tests

FITC Anti-Human CD81 Antibody[1.3.3.22]

Sign In for Pricing
View Details
FITC Anti-Human CD81 Antibody[1.3.3.22]
E-AB-F1073C-03 2x 100 Tests

FITC Anti-Human CD81 Antibody[1.3.3.22]

Sign In for Pricing
View Details