Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PGBD2 Peptide - middle region

PGBD2 Peptide - middle region

Product Specifications

UniProt

Q6P3X8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PGBD2 Rabbit Polyclonal Antibody (orb330754) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001017434

Preservative

Lyophilized powder

AA Sequence

GTVREYRTERCPLKDPKELKKMKRGSFDYKVDESEEIIVCRWHDSSVVNI

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sodium stibogluconate
BUP17415 100 mg

Sodium stibogluconate

Sign In for Pricing
View Details
Ppp1r13b-set siRNA/shRNA/RNAi Lentivector (Mouse)
37408094 4x 500 ng

Ppp1r13b-set siRNA/shRNA/RNAi Lentivector (Mouse)

Sign In for Pricing
View Details
ABCA3 Protein Vector (Mouse) (pPM-C-HA)
11018025 500 ng

ABCA3 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Cytochrome P450 7A1 (CYP7A1) Polyclonal Antibody
CAU33377-01 100 µL

Cytochrome P450 7A1 (CYP7A1) Polyclonal Antibody

Sign In for Pricing
View Details
Cytochrome P450 7A1 (CYP7A1) Polyclonal Antibody
CAU33377-02 200 µL

Cytochrome P450 7A1 (CYP7A1) Polyclonal Antibody

Sign In for Pricing
View Details
Cytochrome P450 7A1 (CYP7A1) Polyclonal Antibody
CAU33377-03 1 mL

Cytochrome P450 7A1 (CYP7A1) Polyclonal Antibody

Sign In for Pricing
View Details