Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PGBD2 Peptide - middle region

PGBD2 Peptide - middle region

Product Specifications

UniProt

Q6P3X8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PGBD2 Rabbit Polyclonal Antibody (orb330754) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001017434

Preservative

Lyophilized powder

AA Sequence

GTVREYRTERCPLKDPKELKKMKRGSFDYKVDESEEIIVCRWHDSSVVNI

More Discoveries

Explore Other Products

Browse additional items from our catalog

C2cd2 siRNA Oligos set (Mouse)
14383174 3x 5 nmol

C2cd2 siRNA Oligos set (Mouse)

Sign In for Pricing
View Details
SLC15A2 3'UTR GFP Stable Cell Line
TU073401 1.0 mL

SLC15A2 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
KIFC1 Recombinant Antibody, Cy5 Conjugated
bsm-61099R-Cy5-TR 20 µL

KIFC1 Recombinant Antibody, Cy5 Conjugated

Sign In for Pricing
View Details
Recombinant Mouse NEDD4 family-interacting protein 1 (Ndfip1), partial
MBS7095320 Inquire

Recombinant Mouse NEDD4 family-interacting protein 1 (Ndfip1), partial

Sign In for Pricing
View Details
N6AMT2 Polyclonal Antibody
A70631-050 50 µL

N6AMT2 Polyclonal Antibody

Sign In for Pricing
View Details
CD226 (NM_006566) Human Tagged ORF Clone Lentiviral Particle
RC210437L3V 200 µL

CD226 (NM_006566) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details