Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DUSP9 Peptide - C-terminal region

DUSP9 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MKP-4, MKP4

UniProt

Q99956

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DUSP9 Rabbit Polyclonal Antibody (orb585190) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001386

Preservative

Lyophilized powder

AA Sequence

SLNDAYDLVKRKKSNISPNFNFMGQLLDFERSLRLEERHSQEQGSGGQAS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human OCLN shRNA (UAS) - Lentiviral human OCLN shRNA (UAS, RFP) (100)
GTR15316083 1 Vial

Lentiviral human OCLN shRNA (UAS) - Lentiviral human OCLN shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
Glypican-5 Polyclonal Antibody
JOT-AP03614-01 20 µL

Glypican-5 Polyclonal Antibody

Sign In for Pricing
View Details
Glypican-5 Polyclonal Antibody
JOT-AP03614-02 50 μL

Glypican-5 Polyclonal Antibody

Sign In for Pricing
View Details
Glypican-5 Polyclonal Antibody
JOT-AP03614-03 100 µL

Glypican-5 Polyclonal Antibody

Sign In for Pricing
View Details
Mouse Monoclonal TSLP Antibody (55N2D4) [HRP]
NBP2-27325H 0.1 mL

Mouse Monoclonal TSLP Antibody (55N2D4) [HRP]

Sign In for Pricing
View Details
ATP6V1B2 (V-type Proton ATPase Subunit B, Brain Isoform, V-ATPase Subunit B 2, Endomembrane Proton Pump 58kD Subunit, HO57, Vacuolar Proton Pump Subunit B 2, ATP6B2, VPP3) (HRP)
123726-HRP 100 µL

ATP6V1B2 (V-type Proton ATPase Subunit B, Brain Isoform, V-ATPase Subunit B 2, Endomembrane Proton Pump 58kD Subunit, HO57, Vacuolar Proton Pump Subunit B 2, ATP6B2, VPP3) (HRP)

Sign In for Pricing
View Details