Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CES3 Peptide - middle region

CES3 Peptide - middle region

Product Specifications

Product Name Alternative

ES31, FLJ21736

UniProt

Q6UWW8

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CES3 Rabbit Polyclonal Antibody (orb585195) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_079198

Preservative

Lyophilized powder

AA Sequence

TPGIIDSHPWPLAQKIANTLACSSSSPAEMVQCLQQKEGEELVLSKKLKN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD274 AAV Vector (Mouse) (CMV)
15516104 1 µg

CD274 AAV Vector (Mouse) (CMV)

Sign In for Pricing
View Details
Dapp1 (NM_011932) Mouse Recombinant Protein
TP503790 20 µg

Dapp1 (NM_011932) Mouse Recombinant Protein

Sign In for Pricing
View Details
Exosc5 ORF Vector (Mouse) (pORF)
ORF044175 1.0 µg DNA

Exosc5 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Matriptase (human), (recombinant) (His-tag)
ALX-201-246-U250 250 U

Matriptase (human), (recombinant) (His-tag)

Sign In for Pricing
View Details
Easypro Human Early Growth Response Protein 2 (EGR2) ELISA Kit
FY-EH2339S 96 Well

Easypro Human Early Growth Response Protein 2 (EGR2) ELISA Kit

Sign In for Pricing
View Details
Anti-SLFN12 Rabbit Monoclonal Antibody
M16669-1-200μl 200 µL

Anti-SLFN12 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details