Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CES3 Peptide - middle region

CES3 Peptide - middle region

Product Specifications

Product Name Alternative

ES31, FLJ21736

UniProt

Q6UWW8

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CES3 Rabbit Polyclonal Antibody (orb585195) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_079198

Preservative

Lyophilized powder

AA Sequence

TPGIIDSHPWPLAQKIANTLACSSSSPAEMVQCLQQKEGEELVLSKKLKN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tryptophanyl-tRNA synthetase 1 Rabbit mAb
E45R12362N-100 100 µL

Tryptophanyl-tRNA synthetase 1 Rabbit mAb

Sign In for Pricing
View Details
Mouse Monoclonal TGF-beta Antibody (TGFB/510) [Biotin]
NBP3-08739B 100 µL

Mouse Monoclonal TGF-beta Antibody (TGFB/510) [Biotin]

Sign In for Pricing
View Details
Mouse Monoclonal EphA2 Antibody (66G9) [Alexa Fluor 488]
NBP2-59479AF488 0.1 mL

Mouse Monoclonal EphA2 Antibody (66G9) [Alexa Fluor 488]

Sign In for Pricing
View Details
MGAT3 3'UTR Luciferase Stable Cell Line
TU013316 1.0 mL

MGAT3 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
COTL1 Rabbit pAb
E2504550 100 µL

COTL1 Rabbit pAb

Sign In for Pricing
View Details
Polyclonal ALAS1 Antibody (aa480-530)
APG01709G 0.05mg

Polyclonal ALAS1 Antibody (aa480-530)

Sign In for Pricing
View Details