SNTB2 Peptide - middle region
SNTB2 Peptide - middle region
Product Specifications
Product Name Alternative
D16S2531E, EST25263, SNT2B2, SNT3, SNTL
UniProt
Q13425
Field of Research
Musculoskeletal & Connective Tissue Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with SNTB2 Rabbit Polyclonal Antibody (orb326451) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_006741
Preservative
Lyophilized powder
AA Sequence
VSDLPWEGAAPQSPSFSGSEDSGSPKHQNSTKDRKIIPLKMCFAARNLSM
More Discoveries
Explore Other Products
Browse additional items from our catalog
S8950-02A-ML550 100 µL
SUV39H2, CT (Histone-lysine N-methyltransferase SUV39H2, Suppressor of Variegation 3-9 Homolog 2, Su (var) 3-9 Homolog 2, Histone H3-K9 Methyltransferase 2, H3-K9-HMTase 2, Lysine N-methyltransferase 1B, KMT1B) (MaxLight 550) discontinued
Sign In for Pricing
View Details 
K6648705 3x 1.0 µg
Kbtbd7 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
Sign In for Pricing
View Details VAng-Cr6683-1mgEcoli 1 mg (E. coli)
Recombinant Pichia pastoris UTR4 Protein (aa 1-235)
Sign In for Pricing
View Details