Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SNTB2 Peptide - middle region

SNTB2 Peptide - middle region

Product Specifications

Product Name Alternative

D16S2531E, EST25263, SNT2B2, SNT3, SNTL

UniProt

Q13425

Field of Research

Musculoskeletal & Connective Tissue Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SNTB2 Rabbit Polyclonal Antibody (orb326451) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_006741

Preservative

Lyophilized powder

AA Sequence

VSDLPWEGAAPQSPSFSGSEDSGSPKHQNSTKDRKIIPLKMCFAARNLSM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DDX23 CRISPR Knock Out 293T Cell Line (Human)
17821141 1x 10^6 Cells / 1.0 mL

DDX23 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
Tissue cDNA, First Strand, Human Diseased (Adult), Diabetes, Spleen, BioGenomicsTM
T5595-0254H7 40 Tests

Tissue cDNA, First Strand, Human Diseased (Adult), Diabetes, Spleen, BioGenomicsTM

Sign In for Pricing
View Details
MAb to JEV NS1
MBS313493-01 1 mg

MAb to JEV NS1

Sign In for Pricing
View Details
MAb to JEV NS1
MBS313493-02 5x 1 mg

MAb to JEV NS1

Sign In for Pricing
View Details
CCDC17 Polyclonal Antibody, Cy5 Conjugated
bs-6928R-Cy5 100 µL

CCDC17 Polyclonal Antibody, Cy5 Conjugated

Sign In for Pricing
View Details
Human Utrophin (UTRN) ELISA Kit
DLR-UTRN-Hu-48T 48 Tests

Human Utrophin (UTRN) ELISA Kit

Sign In for Pricing
View Details