Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MMAA Peptide - N-terminal region

MMAA Peptide - N-terminal region

Product Specifications

Product Name Alternative

MGC120010, MGC120011, MGC120012, MGC120013, cblA

UniProt

Q8IVH4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MMAA Rabbit Polyclonal Antibody (orb585840) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_758454

Preservative

Lyophilized powder

AA Sequence

GQRACLAEAITLVESTHSRKKELAQVLLQKVLLYHREQEQSNKGKPLAFR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Maternal Embryonic Leucine Zipper Kinase (MELK) ELISA Kit
RD-MELK-Hu-01 96 Tests

Human Maternal Embryonic Leucine Zipper Kinase (MELK) ELISA Kit

Sign In for Pricing
View Details
Human Maternal Embryonic Leucine Zipper Kinase (MELK) ELISA Kit
RD-MELK-Hu-02 48 Tests

Human Maternal Embryonic Leucine Zipper Kinase (MELK) ELISA Kit

Sign In for Pricing
View Details
Renilla Luciferase Recombinant Rabbit Monoclonal Antibody [SR07-830]
ET1602-45 100 µL

Renilla Luciferase Recombinant Rabbit Monoclonal Antibody [SR07-830]

Sign In for Pricing
View Details
C1QB (NM_000491) Human Recombinant Protein
TP303821SE 20 µg

C1QB (NM_000491) Human Recombinant Protein

Sign In for Pricing
View Details
Human PUS3 activation kit by CRISPRa
GA113186 1 Kit

Human PUS3 activation kit by CRISPRa

Sign In for Pricing
View Details
XFD660 NHS Ester
1834-AAT 1 mg

XFD660 NHS Ester

Sign In for Pricing
View Details