Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MMAA Peptide - N-terminal region

MMAA Peptide - N-terminal region

Product Specifications

Product Name Alternative

MGC120010, MGC120011, MGC120012, MGC120013, cblA

UniProt

Q8IVH4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MMAA Rabbit Polyclonal Antibody (orb585840) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_758454

Preservative

Lyophilized powder

AA Sequence

GQRACLAEAITLVESTHSRKKELAQVLLQKVLLYHREQEQSNKGKPLAFR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PSG7 Human Gene Knockout Kit (CRISPR)
KN421648 1 Kit

PSG7 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
N-Citryl (R)-Phenylephrine (Mixture of Diastereomers)
TRC-C535720-25MG 25 mg

N-Citryl (R)-Phenylephrine (Mixture of Diastereomers)

Sign In for Pricing
View Details
Dolutegravir
TRC-D528800-50MG 50 mg

Dolutegravir

Sign In for Pricing
View Details
delta 1 Catenin/CAS Rabbit Polyclonal Antibody
ER1901-80 100 µL

delta 1 Catenin/CAS Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Human CCL27 Protein (Trx Tag)
PDEH100528-01 20 µg

Recombinant Human CCL27 Protein (Trx Tag)

Sign In for Pricing
View Details
Recombinant Human CCL27 Protein (Trx Tag)
PDEH100528-02 100 µg

Recombinant Human CCL27 Protein (Trx Tag)

Sign In for Pricing
View Details