Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RASSF2 Peptide - C-terminal region

RASSF2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

DKFZp781O1747, KIAA0168, RASFADIN

UniProt

P50749

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RASSF2 Rabbit Polyclonal Antibody (orb331270) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_055552

Preservative

Lyophilized powder

AA Sequence

YIKFEMPVLKSFIQKLQEEEDREVKKLMRKYTVLRLMIRQRLEEIAETPA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Uroplakin 1A (Urothelial Differentiation Marker) (UPK1A/2925), CF568 conjugate, 0.1mg/mL
BNC682925-500 1x 500 µL

Uroplakin 1A (Urothelial Differentiation Marker) (UPK1A/2925), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Rat PDGF-BB (Platelet-Derived Growth Factor-BB) CLIA Kit
E-CL-R0374-01 24 Tests

Rat PDGF-BB (Platelet-Derived Growth Factor-BB) CLIA Kit

Sign In for Pricing
View Details
Rat PDGF-BB (Platelet-Derived Growth Factor-BB) CLIA Kit
E-CL-R0374-02 48 Tests

Rat PDGF-BB (Platelet-Derived Growth Factor-BB) CLIA Kit

Sign In for Pricing
View Details
Rat PDGF-BB (Platelet-Derived Growth Factor-BB) CLIA Kit
E-CL-R0374-03 96 Tests

Rat PDGF-BB (Platelet-Derived Growth Factor-BB) CLIA Kit

Sign In for Pricing
View Details
Ethyl trans-4-Aminocyclohexanecarboxylate Hydrochloride
TRC-E898100-50MG 50 mg

Ethyl trans-4-Aminocyclohexanecarboxylate Hydrochloride

Sign In for Pricing
View Details
Recombinant Human CD82 (N-Fc)
PKSH033916-01 10 µg

Recombinant Human CD82 (N-Fc)

Sign In for Pricing
View Details