Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RASSF2 Peptide - C-terminal region

RASSF2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

DKFZp781O1747, KIAA0168, RASFADIN

UniProt

P50749

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RASSF2 Rabbit Polyclonal Antibody (orb331270) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_055552

Preservative

Lyophilized powder

AA Sequence

YIKFEMPVLKSFIQKLQEEEDREVKKLMRKYTVLRLMIRQRLEEIAETPA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse TNFSF4/OX40L Protein (His Tag)
PKSM041119-01 10 µg

Recombinant Mouse TNFSF4/OX40L Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Mouse TNFSF4/OX40L Protein (His Tag)
PKSM041119-02 50 µg

Recombinant Mouse TNFSF4/OX40L Protein (His Tag)

Sign In for Pricing
View Details
MMAA (NM_172250) Human Recombinant Protein
TP323205M 100 µg

MMAA (NM_172250) Human Recombinant Protein

Sign In for Pricing
View Details
NRXN3 Human Gene Knockout Kit (CRISPR)
KN423448 1 Kit

NRXN3 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant Human IL17D Protein (Sumo Tag)
PDEH100494-01 20 µg

Recombinant Human IL17D Protein (Sumo Tag)

Sign In for Pricing
View Details
Recombinant Human IL17D Protein (Sumo Tag)
PDEH100494-02 100 µg

Recombinant Human IL17D Protein (Sumo Tag)

Sign In for Pricing
View Details