Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DYRK2 Peptide - C-terminal region

DYRK2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

FLJ21217, FLJ21365

UniProt

Q92630

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DYRK2 Rabbit Polyclonal Antibody (orb585933) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_003574

Preservative

Lyophilized powder

AA Sequence

SVVLNGGRSRRGKLRGPPESREWGNALKGCDDPLFLDFLKQCLEWDPAVR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SOX2 (76-80) Rabbit Polyclonal Antibody
AP26065PU-N 100 µL

SOX2 (76-80) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
AJUBA Human Gene Knockout Kit (CRISPR)
KN205482BN 1 Kit

AJUBA Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Deoxynojirimycin Hydrochloride
TRC-D245005-5MG 5 mg

Deoxynojirimycin Hydrochloride

Sign In for Pricing
View Details
Kcnt1 Mouse Monoclonal Antibody [Clone ID: N3/26]
75-051 100 µL

Kcnt1 Mouse Monoclonal Antibody [Clone ID: N3/26]

Sign In for Pricing
View Details
Human WDR13 activation kit by CRISPRa
GA112112 1 Kit

Human WDR13 activation kit by CRISPRa

Sign In for Pricing
View Details
ARA9 (AIP) Human Gene Knockout Kit (CRISPR)
KN211157LP 1 Kit

ARA9 (AIP) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details