Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DYRK2 Peptide - C-terminal region

DYRK2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

FLJ21217, FLJ21365

UniProt

Q92630

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DYRK2 Rabbit Polyclonal Antibody (orb585933) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_003574

Preservative

Lyophilized powder

AA Sequence

SVVLNGGRSRRGKLRGPPESREWGNALKGCDDPLFLDFLKQCLEWDPAVR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tacc1 Mouse Gene Knockout Kit (CRISPR)
KN517123 1 Kit

Tacc1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
1-Hexanesulfonic Acid Sodium Salt
TRC-H294385-50G 50 g

1-Hexanesulfonic Acid Sodium Salt

Sign In for Pricing
View Details
Recombinant Rat TrkA/NTRK1 Protein (His Tag)
PKSR030180 100 µg

Recombinant Rat TrkA/NTRK1 Protein (His Tag)

Sign In for Pricing
View Details
Reg3g Mouse Gene Knockout Kit (CRISPR)
KN514653 1 Kit

Reg3g Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
EBY100 Yeast Strains
S0117 100 µL

EBY100 Yeast Strains

Sign In for Pricing
View Details
QPCT Antibody (Biotin)
KB-7754-01 50 μL

QPCT Antibody (Biotin)

Sign In for Pricing
View Details