Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LPAR4 Peptide - C-terminal region

LPAR4 Peptide - C-terminal region

Product Specifications

Product Name Alternative

GPR23, LPA4, P2RY9, P2Y5-LIKE, P2Y9

UniProt

Q99677

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LPAR4 Rabbit Polyclonal Antibody (orb326508) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005287

Preservative

Lyophilized powder

AA Sequence

SFYINAHIRMESLFKTETPLTTKPSLPAIQEEVSDQTTNNGGELMLESTF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OCLM Protein Vector (Human) (pPM-C-His)
PV055760 500 ng

OCLM Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
FAM62C Rabbit pAb, BF700 conjugated
orb2856770 100 µL

FAM62C Rabbit pAb, BF700 conjugated

Sign In for Pricing
View Details
Human FAM171B Protein, Fc Tag
E40KMPH6415 20 µg

Human FAM171B Protein, Fc Tag

Sign In for Pricing
View Details
MEK1 Antibody
orb1333902 100 µg

MEK1 Antibody

Sign In for Pricing
View Details
MTSS1 Rabbit pAb
E45R18589N-50 50 µL

MTSS1 Rabbit pAb

Sign In for Pricing
View Details
Unc18-2 (D-2) : m-IgGκ BP-HRP Bundle
sc-535655 1 Kit

Unc18-2 (D-2) : m-IgGκ BP-HRP Bundle

Sign In for Pricing
View Details