Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LPAR4 Peptide - C-terminal region

LPAR4 Peptide - C-terminal region

Product Specifications

Product Name Alternative

GPR23, LPA4, P2RY9, P2Y5-LIKE, P2Y9

UniProt

Q99677

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LPAR4 Rabbit Polyclonal Antibody (orb326508) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005287

Preservative

Lyophilized powder

AA Sequence

SFYINAHIRMESLFKTETPLTTKPSLPAIQEEVSDQTTNNGGELMLESTF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KLHL6 Overexpression Lysate (Native) - (Dry Ice)
NBL1-12341 0.1 mg

KLHL6 Overexpression Lysate (Native) - (Dry Ice)

Sign In for Pricing
View Details
pUNO1-hZCCHC11a
puno1-hzcchc11 20 µg

pUNO1-hZCCHC11a

Sign In for Pricing
View Details
Chmp4c Mouse shRNA Plasmid (Locus ID 66371)
TR503605 1 Kit

Chmp4c Mouse shRNA Plasmid (Locus ID 66371)

Sign In for Pricing
View Details
Human Agrin CLIA Kit
MBS8425086-01 1 Kit

Human Agrin CLIA Kit

Sign In for Pricing
View Details
Human Agrin CLIA Kit
MBS8425086-02 5x 1 Kit

Human Agrin CLIA Kit

Sign In for Pricing
View Details
GONST3 Antibody
orb789809 2 mg

GONST3 Antibody

Sign In for Pricing
View Details