Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LPAR4 Peptide - C-terminal region

LPAR4 Peptide - C-terminal region

Product Specifications

Product Name Alternative

GPR23, LPA4, P2RY9, P2Y5-LIKE, P2Y9

UniProt

Q99677

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LPAR4 Rabbit Polyclonal Antibody (orb326508) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005287

Preservative

Lyophilized powder

AA Sequence

SFYINAHIRMESLFKTETPLTTKPSLPAIQEEVSDQTTNNGGELMLESTF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Amplite® Fluorimetric NADH Assay Kit *Red Fluorescence*
15261-AAT 400 Tests

Amplite® Fluorimetric NADH Assay Kit *Red Fluorescence*

Sign In for Pricing
View Details
CHRNB3 ELISA Kit (Human)
OKCD00895-96W 96 Well

CHRNB3 ELISA Kit (Human)

Sign In for Pricing
View Details
EG331493 shRNA (m) Lentiviral Particles
sc-143444-V 200 µL

EG331493 shRNA (m) Lentiviral Particles

Sign In for Pricing
View Details
RAB31 Human siRNA Oligo Duplex (Locus ID 11031)
SR307545 1 Kit

RAB31 Human siRNA Oligo Duplex (Locus ID 11031)

Sign In for Pricing
View Details
SEMA3F sgRNA CRISPR Lentivector (Human) (Target 3)
K2116304 1.0 µg DNA

SEMA3F sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
ERAP2 antibody
70R-17126 50 ul

ERAP2 antibody

Sign In for Pricing
View Details