Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LPAR4 Peptide - C-terminal region

LPAR4 Peptide - C-terminal region

Product Specifications

Product Name Alternative

GPR23, LPA4, P2RY9, P2Y5-LIKE, P2Y9

UniProt

Q99677

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LPAR4 Rabbit Polyclonal Antibody (orb326508) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005287

Preservative

Lyophilized powder

AA Sequence

SFYINAHIRMESLFKTETPLTTKPSLPAIQEEVSDQTTNNGGELMLESTF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bdh2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)
K6312107 1.0 µg DNA

Bdh2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
HMGA1 Rabbit Polyclonal Antibody
orb215477-01 30 µL

HMGA1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
HMGA1 Rabbit Polyclonal Antibody
orb215477-02 50 μL

HMGA1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
HMGA1 Rabbit Polyclonal Antibody
orb215477-03 100 µL

HMGA1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
HMGA1 Rabbit Polyclonal Antibody
orb215477-04 200 µL

HMGA1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
S&P DNA Prep Buffer (10 mL)
D4076-3-10 10 mL

S&P DNA Prep Buffer (10 mL)

Sign In for Pricing
View Details