Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IDO2 Peptide - N-terminal region

IDO2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

INDOL1

UniProt

F5H5G0

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with IDO2 Rabbit Polyclonal Antibody (orb586056) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_919270

Preservative

Lyophilized powder

AA Sequence

YRPWMEIANKLPQLIDAHQLQAHVDKMPLLSCQFLKGHREQRLAHLVLSF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Blocks, Prostate
CB516139 1 Block

Frozen Tissue Blocks, Prostate

Sign In for Pricing
View Details
Mouse Capza1 activation kit by CRISPRa
GA200519 1 Kit

Mouse Capza1 activation kit by CRISPRa

Sign In for Pricing
View Details
Boc-Cys(Trt)-OH
TRC-B646293-1G 1 g

Boc-Cys(Trt)-OH

Sign In for Pricing
View Details
Human SEMA4D (Semaphorin 4D) ELISA Kit
E-EL-H2252-01 24 Tests

Human SEMA4D (Semaphorin 4D) ELISA Kit

Sign In for Pricing
View Details
Human SEMA4D (Semaphorin 4D) ELISA Kit
E-EL-H2252-02 48 Tests

Human SEMA4D (Semaphorin 4D) ELISA Kit

Sign In for Pricing
View Details
Human SEMA4D (Semaphorin 4D) ELISA Kit
E-EL-H2252-03 96 Tests

Human SEMA4D (Semaphorin 4D) ELISA Kit

Sign In for Pricing
View Details