Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IDO2 Peptide - N-terminal region

IDO2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

INDOL1

UniProt

F5H5G0

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with IDO2 Rabbit Polyclonal Antibody (orb586056) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_919270

Preservative

Lyophilized powder

AA Sequence

YRPWMEIANKLPQLIDAHQLQAHVDKMPLLSCQFLKGHREQRLAHLVLSF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

3-Acetylphenylboronic acid
TRC-A188838-500MG 500 mg

3-Acetylphenylboronic acid

Sign In for Pricing
View Details
Alpha-D-Glucosamine Pentaacetate
TRC-G515001-25G 25 g

Alpha-D-Glucosamine Pentaacetate

Sign In for Pricing
View Details
Recombinant Human Thioredoxin/TXN Protein (His Tag)
PKSH033108-01 10 µg

Recombinant Human Thioredoxin/TXN Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human Thioredoxin/TXN Protein (His Tag)
PKSH033108-02 50 µg

Recombinant Human Thioredoxin/TXN Protein (His Tag)

Sign In for Pricing
View Details
2-Thiobarbituric Acid
TRC-T344375-5G 5 g

2-Thiobarbituric Acid

Sign In for Pricing
View Details
Mouse Thyroid Stimulating Hormone Receptor (TSHR) ELISA Kit
RD-TSHR-Mu-01 96 Tests

Mouse Thyroid Stimulating Hormone Receptor (TSHR) ELISA Kit

Sign In for Pricing
View Details