Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GPR65 Peptide - C-terminal region

GPR65 Peptide - C-terminal region

Product Specifications

Product Name Alternative

TDAG8, hTDAG8

UniProt

Q8IYL9

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GPR65 Rabbit Polyclonal Antibody (orb586072) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_003599

Preservative

Lyophilized powder

AA Sequence

LEKWQINLNLFRTCTGYAIPLVTILICNRKVYQAVRHNKATENKEKKRII

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

N-Oxo Samidorphan
TRC-O311980-50MG 50 mg

N-Oxo Samidorphan

Sign In for Pricing
View Details
Z-L-Phenylglycine
TRC-P327305-25G 25 g

Z-L-Phenylglycine

Sign In for Pricing
View Details
(2S,3R)-3-Acetoxy-2-aminobutanoic Acid
TRC-A164313-1G 1 g

(2S,3R)-3-Acetoxy-2-aminobutanoic Acid

Sign In for Pricing
View Details
Colloidal Gold Conjugated Swine Affinity Purified Antibody to Goat IgG, 1mL 40nm
GAF-014-40 1 mL

Colloidal Gold Conjugated Swine Affinity Purified Antibody to Goat IgG, 1mL 40nm

Sign In for Pricing
View Details
CD22 / BL-CAM (B-Cell Marker) (RFB4), CF405S conjugate, 0.1mg/mL
BNC041594-100 1x 100 µL

CD22 / BL-CAM (B-Cell Marker) (RFB4), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant FTO Monoclonal Antibody
E-AB-81470-01 50 µL

Recombinant FTO Monoclonal Antibody

Sign In for Pricing
View Details