Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GPR65 Peptide - C-terminal region

GPR65 Peptide - C-terminal region

Product Specifications

Product Name Alternative

TDAG8, hTDAG8

UniProt

Q8IYL9

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GPR65 Rabbit Polyclonal Antibody (orb586072) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_003599

Preservative

Lyophilized powder

AA Sequence

LEKWQINLNLFRTCTGYAIPLVTILICNRKVYQAVRHNKATENKEKKRII

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1-(Alpha,Alpha,Alpha-Trifluoro-m-tolyl)piperazine-d8 Hydrochloride
TRC-T793502-1MG 1 mg

1-(Alpha,Alpha,Alpha-Trifluoro-m-tolyl)piperazine-d8 Hydrochloride

Sign In for Pricing
View Details
Frozen Tissue Sections, Ovary: left
CS629597 5x 5 µm

Frozen Tissue Sections, Ovary: left

Sign In for Pricing
View Details
VEGF-R2 / CD309 / Flk-1 / KDR3 (DC101), Biotin conjugate, 0.1mg/mL
BNCB0531-500 1x 500 µL

VEGF-R2 / CD309 / Flk-1 / KDR3 (DC101), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
1,5-Diaminonaphthalene-d6
TRC-D416417-25MG 25 mg

1,5-Diaminonaphthalene-d6

Sign In for Pricing
View Details
GFAP (GA-5 + ASTRO/789), CF568 conjugate, 0.1mg/mL
BNC680898-100 1x 100 µL

GFAP (GA-5 + ASTRO/789), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CFTR (Cystic Fibrosis Transmembrane Conductance Regulator) (CFTR/1775R), CF405S conjugate, 0.1mg/mL
BNC041775-500 1x 500 µL

CFTR (Cystic Fibrosis Transmembrane Conductance Regulator) (CFTR/1775R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details