Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL26 Peptide - N-terminal region

IL26 Peptide - N-terminal region

Product Specifications

Product Name Alternative

AK155, IL-26

UniProt

Q9NPH9

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with IL26 Rabbit Polyclonal Antibody (orb586074) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_060872

Preservative

Lyophilized powder

AA Sequence

IKAAWLKATIPEDRIKNIRLLKKKTKKQFMKNCQFQEQLLSFFMEDVFGQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BCL7B (NM_001707) Human Over-expression Lysate
LY419788 100 µg

BCL7B (NM_001707) Human Over-expression Lysate

Sign In for Pricing
View Details
Tissue FFPE Sections, Metastasis, unknown source
CS808199 5x 5 µm

Tissue FFPE Sections, Metastasis, unknown source

Sign In for Pricing
View Details
PPM1A (NM_177952) Human Recombinant Protein
TP329231M 100 µg

PPM1A (NM_177952) Human Recombinant Protein

Sign In for Pricing
View Details
3-Butenyl isothiocyanate
TRC-B999100-250MG 250 mg

3-Butenyl isothiocyanate

Sign In for Pricing
View Details
Human FGF19 (Fibroblast Growth Factor 19) ELISA Kit
E-EL-H0073-01 24 Tests

Human FGF19 (Fibroblast Growth Factor 19) ELISA Kit

Sign In for Pricing
View Details
Human FGF19 (Fibroblast Growth Factor 19) ELISA Kit
E-EL-H0073-02 48 Tests

Human FGF19 (Fibroblast Growth Factor 19) ELISA Kit

Sign In for Pricing
View Details