Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL26 Peptide - N-terminal region

IL26 Peptide - N-terminal region

Product Specifications

Product Name Alternative

AK155, IL-26

UniProt

Q9NPH9

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with IL26 Rabbit Polyclonal Antibody (orb586074) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_060872

Preservative

Lyophilized powder

AA Sequence

IKAAWLKATIPEDRIKNIRLLKKKTKKQFMKNCQFQEQLLSFFMEDVFGQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Convicine-15N,13C
TRC-C685097-5MG 5 mg

Convicine-15N,13C

Sign In for Pricing
View Details
MPRA Antibody
8G388-AAT 50 µg

MPRA Antibody

Sign In for Pricing
View Details
UBR7 Antibody
KC-2182-01 50 μL

UBR7 Antibody

Sign In for Pricing
View Details
UBR7 Antibody
KC-2182-02 100 µL

UBR7 Antibody

Sign In for Pricing
View Details
UBR7 Antibody
KC-2182-03 1 mL

UBR7 Antibody

Sign In for Pricing
View Details
Human ZNF599 activation kit by CRISPRa
GA115651 1 Kit

Human ZNF599 activation kit by CRISPRa

Sign In for Pricing
View Details