Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FKBP10 Peptide - N-terminal region

FKBP10 Peptide - N-terminal region

Product Specifications

Product Name Alternative

FKBP65, FLJ20683, FLJ22041, FLJ23833, PPIASE, hFKBP65, OI6, OI11

UniProt

Q96AY3

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with FKBP10 Rabbit Polyclonal Antibody (orb586148) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_068758

Preservative

Lyophilized powder

AA Sequence

VRYHYNGTFEDGKKFDSSYDRNTLVAIVVGVGRLITGMDRGLMGMCVNER

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FOXP3 (3G3), CF647 conjugate, 0.1mg/mL
BNC470645-500 1x 500 µL

FOXP3 (3G3), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (C8/1035), CF647 conjugate, 0.1mg/mL
BNC471035-500 1x 500 µL

CD8 (C8/1035), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, LMW (AE-1), CF647 conjugate, 0.1mg/mL
BNC470253-100 1x 100 µL

Cytokeratin, LMW (AE-1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (TV-1), CF488A conjugate, 0.1mg/mL
BNC880029-500 1x 500 µL

Fibronectin (TV-1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD21 (Mature B-Cell & Follicular Dendritic Cell Marker) (CR2/1952), CF405S conjugate, 0.1mg/mL
BNC041952-500 1x 500 µL

CD21 (Mature B-Cell & Follicular Dendritic Cell Marker) (CR2/1952), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45 / LCA (2B11), CF594 conjugate, 0.1mg/mL
BNC940470-500 1x 500 µL

CD45 / LCA (2B11), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details