Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TFPT Peptide - C-terminal region

TFPT Peptide - C-terminal region

Product Specifications

Product Name Alternative

FB1, INO80F, amida

UniProt

P0C1Z6

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TFPT Rabbit Polyclonal Antibody (orb586160) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_037474

Preservative

Lyophilized powder

AA Sequence

PEPGSPAPGEGPSGRKRRRVPRDGRRAGNALTPELAPVQIKVEEDFGFEA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Porcine Peptide YY, PYY ELISA KIT
EA0051Po-01 96 Well

Porcine Peptide YY, PYY ELISA KIT

Sign In for Pricing
View Details
Nat3 ORF Vector (Rat) (pORF)
31476016 1.0 µg DNA

Nat3 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
KLF4 Recombinant Protein
OPCD04683-50UG 50 µg

KLF4 Recombinant Protein

Sign In for Pricing
View Details
Ngdn AAV siRNA Pooled Vector
31797166 1.0 µg

Ngdn AAV siRNA Pooled Vector

Sign In for Pricing
View Details
OTUD6A Antibody (Center)
orb29968-01 50 µL

OTUD6A Antibody (Center)

Sign In for Pricing
View Details
OTUD6A Antibody (Center)
orb29968-02 100 µL

OTUD6A Antibody (Center)

Sign In for Pricing
View Details