Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TFPT Peptide - C-terminal region

TFPT Peptide - C-terminal region

Product Specifications

Product Name Alternative

FB1, INO80F, amida

UniProt

P0C1Z6

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TFPT Rabbit Polyclonal Antibody (orb586160) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_037474

Preservative

Lyophilized powder

AA Sequence

PEPGSPAPGEGPSGRKRRRVPRDGRRAGNALTPELAPVQIKVEEDFGFEA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Angiopoietin Like Protein 6 (ANGPTL6) ELISA Kit
DLR-ANGPTL6-Ra-48T 48 Tests

Rat Angiopoietin Like Protein 6 (ANGPTL6) ELISA Kit

Sign In for Pricing
View Details
Rabbit Anti-Chicken IgG H&L Secondary Antibody-AF488
TMAB-02022AF488-01 100 µL

Rabbit Anti-Chicken IgG H&L Secondary Antibody-AF488

Sign In for Pricing
View Details
Rabbit Anti-Chicken IgG H&L Secondary Antibody-AF488
TMAB-02022AF488-02 1 mL

Rabbit Anti-Chicken IgG H&L Secondary Antibody-AF488

Sign In for Pricing
View Details
FABP6 Rabbit Polyclonal Antibody (Biotin)
orb2606476 100 µg

FABP6 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
FBXL7 Antibody Blocking peptide
orb1443751 500 µg

FBXL7 Antibody Blocking peptide

Sign In for Pricing
View Details
Fgf4 siRNA Oligos set (Rat)
20505176 3x 5 nmol

Fgf4 siRNA Oligos set (Rat)

Sign In for Pricing
View Details