Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BIN3 Peptide - C-terminal region

BIN3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MGC14978

UniProt

Q9NQY0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with BIN3 Rabbit Polyclonal Antibody (orb586161) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_061158

Preservative

Lyophilized powder

AA Sequence

LDYFQPSFESLIRAQVVYYSEMHKIFGDLSHQLDQPGHSDEQRERENEAK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2,3,3-Trichloro-2-propenesulfonic Acid Sodium Salt
TRC-T797900-50MG 50 mg

2,3,3-Trichloro-2-propenesulfonic Acid Sodium Salt

Sign In for Pricing
View Details
Recombinant Human Tryptophan Hydroxylase 1/TPH1 Protein (His Tag)
PKSH030968 50 µg

Recombinant Human Tryptophan Hydroxylase 1/TPH1 Protein (His Tag)

Sign In for Pricing
View Details
LCN1 (NM_002297) Human Over-expression Lysate
LC419409 20 µg

LCN1 (NM_002297) Human Over-expression Lysate

Sign In for Pricing
View Details
GPR43 (FFAR2) (NM_005306) Human Over-expression Lysate
LY401635 100 µg

GPR43 (FFAR2) (NM_005306) Human Over-expression Lysate

Sign In for Pricing
View Details
BDH1 Human Gene Knockout Kit (CRISPR)
KN400873 1 Kit

BDH1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
AP2M1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1F10]
TA503015AM 100 µL

AP2M1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1F10]

Sign In for Pricing
View Details