PAM16 Peptide - C-terminal region
PAM16 Peptide - C-terminal region
Product Specifications
Product Name Alternative
CGI-136, Magmas
UniProt
Q9Y3D7
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with PAM16 Rabbit Polyclonal Antibody (orb586167) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_057153
Preservative
Lyophilized powder
AA Sequence
NYEHLFKVNDKSVGGSFYLQSKVVRAKERLDEELKIQAQEDREKGQMPHT
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC470500-100 1x 100 µL
Progesterone Receptor (PR500), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC882148-100 1x 100 µL
Cytokeratin, Basic (Type II or HMW) (rKRTH/2148), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
![PDE2A Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4H8]](https://cdn.genprice.uk/products/937/6868c333994c49e6dc3f17eb/imageurl/ta502321bm.webp)
TA502321BM 100 µL
PDE2A Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4H8]
Sign In for Pricing
View Details 