Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RPS11 Peptide - C-terminal region

RPS11 Peptide - C-terminal region

Product Specifications

Product Name Alternative

S11

UniProt

P62280

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RPS11 Rabbit Polyclonal Antibody (orb586170) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001006

Preservative

Lyophilized powder

AA Sequence

MSVHLSPCFRDVQIGDIVTVGECRPLSKTVRFNVLKVTKAAGTKKQFQKF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Myc tag Mouse Monoclonal Antibody [A3C8]
EM1902-38 100 µL

Myc tag Mouse Monoclonal Antibody [A3C8]

Sign In for Pricing
View Details
ARNT2 (NM_014862) Human Over-expression Lysate
LC402381 20 µg

ARNT2 (NM_014862) Human Over-expression Lysate

Sign In for Pricing
View Details
2,4-Dibromobenzoic acid
TRC-D426010-5G 5 g

2,4-Dibromobenzoic acid

Sign In for Pricing
View Details
Recombinant Mouse Sonic Hedgehog/SHH Protein
PKSM041194-01 10 µg

Recombinant Mouse Sonic Hedgehog/SHH Protein

Sign In for Pricing
View Details
Recombinant Mouse Sonic Hedgehog/SHH Protein
PKSM041194-02 50 µg

Recombinant Mouse Sonic Hedgehog/SHH Protein

Sign In for Pricing
View Details
ATG16L1 (NM_001190266) Human Over-expression Lysate
LC434295 20 µg

ATG16L1 (NM_001190266) Human Over-expression Lysate

Sign In for Pricing
View Details