Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RPS11 Peptide - C-terminal region

RPS11 Peptide - C-terminal region

Product Specifications

Product Name Alternative

S11

UniProt

P62280

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RPS11 Rabbit Polyclonal Antibody (orb586170) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001006

Preservative

Lyophilized powder

AA Sequence

MSVHLSPCFRDVQIGDIVTVGECRPLSKTVRFNVLKVTKAAGTKKQFQKF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Leukotriene A4 Hydrolase Antibody
RC-16062-01 50 μL

Recombinant Leukotriene A4 Hydrolase Antibody

Sign In for Pricing
View Details
Recombinant Leukotriene A4 Hydrolase Antibody
RC-16062-02 100 µL

Recombinant Leukotriene A4 Hydrolase Antibody

Sign In for Pricing
View Details
Recombinant Leukotriene A4 Hydrolase Antibody
RC-16062-03 1 mL

Recombinant Leukotriene A4 Hydrolase Antibody

Sign In for Pricing
View Details
CD30 / TNFRSF8 (Hodgkin & Reed-Sternberg Cell Marker) (Ki-1/1747R), CF647 conjugate, 0.1mg/mL
BNC471747-500 1x 500 µL

CD30 / TNFRSF8 (Hodgkin & Reed-Sternberg Cell Marker) (Ki-1/1747R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
LITAF (NM_001136473) Human Over-expression Lysate
LY427884 100 µg

LITAF (NM_001136473) Human Over-expression Lysate

Sign In for Pricing
View Details
PINK1 Human Gene Knockout Kit (CRISPR)
KN206970RB 1 Kit

PINK1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details