Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RPS11 Peptide - N-terminal region

RPS11 Peptide - N-terminal region

Product Specifications

Product Name Alternative

S11

UniProt

P62280

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RPS11 Rabbit Polyclonal Antibody (orb586171) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001006

Preservative

Lyophilized powder

AA Sequence

DIQTERAYQKQPTIFQNKKRVLLGETGKEKLPRYYKNIGLGFKTPKEAIE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ESC swab Buffered Peptone Water 10 mL
85603 100/Pack

ESC swab Buffered Peptone Water 10 mL

Sign In for Pricing
View Details
RPS19P1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K2039205 3x 1.0 µg

RPS19P1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
GST Tag Rabbit mAb Antibody
orb3130829-01 100 µL

GST Tag Rabbit mAb Antibody

Sign In for Pricing
View Details
GST Tag Rabbit mAb Antibody
orb3130829-02 500 µL

GST Tag Rabbit mAb Antibody

Sign In for Pricing
View Details
GST Tag Rabbit mAb Antibody
orb3130829-03 1 mL

GST Tag Rabbit mAb Antibody

Sign In for Pricing
View Details
SMAD4 Antibody: HRP
MBS8000584-01 0.1 mg

SMAD4 Antibody: HRP

Sign In for Pricing
View Details