Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RPS11 Peptide - N-terminal region

RPS11 Peptide - N-terminal region

Product Specifications

Product Name Alternative

S11

UniProt

P62280

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RPS11 Rabbit Polyclonal Antibody (orb586171) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001006

Preservative

Lyophilized powder

AA Sequence

DIQTERAYQKQPTIFQNKKRVLLGETGKEKLPRYYKNIGLGFKTPKEAIE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Anti-Mucin-1 antibody
SLM-43025M-01 50 µL

Mouse Anti-Mucin-1 antibody

Sign In for Pricing
View Details
Mouse Anti-Mucin-1 antibody
SLM-43025M-02 100 µL

Mouse Anti-Mucin-1 antibody

Sign In for Pricing
View Details
Mouse Anti-Mucin-1 antibody
SLM-43025M-03 200 µL

Mouse Anti-Mucin-1 antibody

Sign In for Pricing
View Details
Anti-MHC Class II HLA-DPB1 Rabbit Monoclonal Antibody
M00487-1 100 µL/Vial

Anti-MHC Class II HLA-DPB1 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
FAM179A (TOGARAM2) (NM_199280) Human Tagged ORF Clone Lentiviral Particle
RC212833L4V 200 µL

FAM179A (TOGARAM2) (NM_199280) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
1-tert-Butylamino-3-chloro-2-propanol hydrochloride
sc-473534 100 mg

1-tert-Butylamino-3-chloro-2-propanol hydrochloride

Sign In for Pricing
View Details