Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FFAR2 Peptide - C-terminal region

FFAR2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

FFA2R, GPR43

UniProt

O15552

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with FFAR2 Rabbit Polyclonal Antibody (orb586175) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005297

Preservative

Lyophilized powder

AA Sequence

RRAFGRGLQVLRNQGSSLLGRRGKDTAEGTNEDRGVGQGEGMPSSDFTTE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LMAN1L Polyclonal Antibody
A56262-020 20 µL

LMAN1L Polyclonal Antibody

Sign In for Pricing
View Details
Rat Anti-Mouse IgA-HRP
1165-05 1.0 mL

Rat Anti-Mouse IgA-HRP

Sign In for Pricing
View Details
CD39 (HRP)
227416-HRP 100 µL

CD39 (HRP)

Sign In for Pricing
View Details
8-Hydroxyodoroside A
orb1683285 5 mg

8-Hydroxyodoroside A

Sign In for Pricing
View Details
FGF2 Antibody
orb3159801-01 50 µL

FGF2 Antibody

Sign In for Pricing
View Details
FGF2 Antibody
orb3159801-02 100 µL

FGF2 Antibody

Sign In for Pricing
View Details