Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IMP4 Peptide - C-terminal region

IMP4 Peptide - C-terminal region

Product Specifications

Product Name Alternative

BXDC4, MGC19606

UniProt

Q96G21

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with IMP4 Rabbit Polyclonal Antibody (orb586179) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_219484

Preservative

Lyophilized powder

AA Sequence

VELTEVGPRFELKLYMIRLGTLEQEATADVEWRWHPYTNTARKRVFLSTE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Alkaline Phosphatase/ALPL Antibody Picoband®, APC Conjugate
PA1004-1-APC 100 µg/Vial

Anti-Alkaline Phosphatase/ALPL Antibody Picoband®, APC Conjugate

Sign In for Pricing
View Details
AZT triphosphate tetraammonium
MBS5815902 Inquire

AZT triphosphate tetraammonium

Sign In for Pricing
View Details
CD306 Antibody
OM636780-01 100 µL

CD306 Antibody

Sign In for Pricing
View Details
CD306 Antibody
OM636780-02 20 µL

CD306 Antibody

Sign In for Pricing
View Details
CD306 Antibody
OM636780-03 50 µL

CD306 Antibody

Sign In for Pricing
View Details
PEX13 Antibody Blocking peptide
orb1444778 500 µg

PEX13 Antibody Blocking peptide

Sign In for Pricing
View Details