Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LXN Peptide - N-terminal region

LXN Peptide - N-terminal region

Product Specifications

Product Name Alternative

ECI, TCI

UniProt

Q9BS40

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LXN Rabbit Polyclonal Antibody (orb586180) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_064554

Preservative

Lyophilized powder

AA Sequence

NCTAEVLYPSTGQETAPEVNFTFEGETGKNPDEEDNTFYQRLKSMKEPLE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NVL (NM_002533) Human Recombinant Protein
TP315387 20 µg

NVL (NM_002533) Human Recombinant Protein

Sign In for Pricing
View Details
ITM2A (NM_001171581) Human Over-expression Lysate
LC432712 20 µg

ITM2A (NM_001171581) Human Over-expression Lysate

Sign In for Pricing
View Details
Frozen Tissue Sections, Thyroid gland
CS628945 5x 5 µm

Frozen Tissue Sections, Thyroid gland

Sign In for Pricing
View Details
AP2A2 Rabbit Polyclonal Antibody
HA500477 100 µL

AP2A2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TIM3 / HAVCR2 / CD366 (Effector T-Cell Marker) (TIM3/3113), CF594 conjugate, 0.1mg/mL
BNC943113-500 1x 500 µL

TIM3 / HAVCR2 / CD366 (Effector T-Cell Marker) (TIM3/3113), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
10-Heneicosanone
TRC-H105390-50MG 50 mg

10-Heneicosanone

Sign In for Pricing
View Details