Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LXN Peptide - N-terminal region

LXN Peptide - N-terminal region

Product Specifications

Product Name Alternative

ECI, TCI

UniProt

Q9BS40

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LXN Rabbit Polyclonal Antibody (orb586180) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_064554

Preservative

Lyophilized powder

AA Sequence

NCTAEVLYPSTGQETAPEVNFTFEGETGKNPDEEDNTFYQRLKSMKEPLE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Filamin A Recombinant Rabbit Monoclonal Antibody [SA30-08]
ET1601-3 100 µL

Filamin A Recombinant Rabbit Monoclonal Antibody [SA30-08]

Sign In for Pricing
View Details
Human CCDC78 activation kit by CRISPRa
GA114829 1 Kit

Human CCDC78 activation kit by CRISPRa

Sign In for Pricing
View Details
Recombinant SARS-CoV-2 Spike RBD (F377L) (His Tag)
PKSV030424 100 µg

Recombinant SARS-CoV-2 Spike RBD (F377L) (His Tag)

Sign In for Pricing
View Details
Human Kappa Light Chain (KLC264), CF568 conjugate, 0.1mg/mL
BNC680264-100 1x 100 µL

Human Kappa Light Chain (KLC264), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
1,2,3-Trichloropropene
TRC-C010100-500MG 500 mg

1,2,3-Trichloropropene

Sign In for Pricing
View Details
CF®594 Amine
#92040 1x 1 mg

CF®594 Amine

Sign In for Pricing
View Details