Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

P2RY14 Peptide - C-terminal region

P2RY14 Peptide - C-terminal region

Product Specifications

Product Name Alternative

GPR105, KIAA0001, P2Y14

UniProt

Q15391

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with P2RY14 Rabbit Polyclonal Antibody (orb586186) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_055694

Preservative

Lyophilized powder

AA Sequence

LKSSRNSTSVKKKSSRNIFSIVFVFFVCFVPYHIARIPYTKSQTEAHYSC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EMA (MUC1) (NM_001018017) Human Over-expression Lysate
LC422695 20 µg

EMA (MUC1) (NM_001018017) Human Over-expression Lysate

Sign In for Pricing
View Details
Human G-CSF Recombinant Rabbit monoclonal Antibody
HA725002 100 µL

Human G-CSF Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
trans,trans,trans-1,5,9-Cyclododecatrene
TRC-T221160-500MG 500 mg

trans,trans,trans-1,5,9-Cyclododecatrene

Sign In for Pricing
View Details
PEX10 (NM_002617) Human Over-expression Lysate
LY419217 100 µg

PEX10 (NM_002617) Human Over-expression Lysate

Sign In for Pricing
View Details
CD66 (CEA) (COL-1 + CEA31 + C66/261), CF640R conjugate, 0.1mg/mL
BNC400747-500 1x 500 µL

CD66 (CEA) (COL-1 + CEA31 + C66/261), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Horizontal head, for 2 x 50ml
BV1000-H500 1 Each

Horizontal head, for 2 x 50ml

Sign In for Pricing
View Details