Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

P2RY14 Peptide - C-terminal region

P2RY14 Peptide - C-terminal region

Product Specifications

Product Name Alternative

GPR105, KIAA0001, P2Y14

UniProt

Q15391

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with P2RY14 Rabbit Polyclonal Antibody (orb586186) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_055694

Preservative

Lyophilized powder

AA Sequence

LKSSRNSTSVKKKSSRNIFSIVFVFFVCFVPYHIARIPYTKSQTEAHYSC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ki67 Recombinant Rabbit monoclonal Antibody
IRS057 100 µL

Ki67 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Human FSIP2 activation kit by CRISPRa
GA118300 1 Kit

Human FSIP2 activation kit by CRISPRa

Sign In for Pricing
View Details
Sprr2e Mouse Gene Knockout Kit (CRISPR)
KN516660 1 Kit

Sprr2e Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CAMK2A Human Gene Knockout Kit (CRISPR)
KN205202RB 1 Kit

CAMK2A Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Benzyl Alcohol
TRC-T536635-250G 250 g

Benzyl Alcohol

Sign In for Pricing
View Details
Elab Fluor® 700 Rat IgG2a, λ Isotype Control[B39-4]
E-AB-F09743M1-01 25 µg

Elab Fluor® 700 Rat IgG2a, λ Isotype Control[B39-4]

Sign In for Pricing
View Details