RPL21 Peptide - middle region
RPL21 Peptide - middle region
Product Specifications
Product Name Alternative
DKFZp686C06101, FLJ27458, L21, MGC104274, MGC104275, MGC71252
UniProt
P46778
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with RPL21 Rabbit Polyclonal Antibody (orb326524) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_000973
Preservative
Lyophilized powder
AA Sequence
QVKGKILAKRINVRIEHIKHSKSRDSFLKRVKENDQKKKEAKEKGTWVQL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GTR15244851 1 Vial
Lentiviral mouse Pes1 shRNA (UAS) - Lentiviral mouse Pes1 shRNA (UAS, iRFP) (100)
Sign In for Pricing
View Details 
044009-ML650 100 µL
ZBTB7A, CT (ZBTB7A, FBI1, LRF, ZBTB7, ZNF857A, Zinc finger and BTB domain-containing protein 7A, Factor binding IST protein 1, Factor that binds to inducer of short transcripts protein 1, HIV-1 1st-binding protein 1, Leukemia/lymphoma-related factor, POZ and Krueppel erythroid myeloid ontogenic factor, TTF-I-interacting peptide 21, Zinc finger protein 857A) (MaxLight 650) discontinued
Sign In for Pricing
View Details MBS1007374-01 0.02 mg (E-Coli)
Recombinant Mycobacterium marinum D-tyrosyl-tRNA (Tyr) deacylase
Sign In for Pricing
View Details MBS1007374-02 0.1 mg (E-Coli)
Recombinant Mycobacterium marinum D-tyrosyl-tRNA (Tyr) deacylase
Sign In for Pricing
View Details MBS1007374-03 0.02 mg (Yeast)
Recombinant Mycobacterium marinum D-tyrosyl-tRNA (Tyr) deacylase
Sign In for Pricing
View Details